| IED ID | IndEnz0002004636 |
| Enzyme Type ID | protease004636 |
| Protein Name |
Flotillin-2 Epidermal surface antigen ESA Membrane component chromosome 17 surface marker 1 homolog |
| Gene Name | Flot2 Esa1 M17s1 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKNATGAQV |
| Enzyme Length | 428 |
| Uniprot Accession Number | Q60634 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles. May be involved in epidermal cell adhesion and epidermal structure and function. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Beta strand (7); Chain (1); Helix (5); Initiator methionine (1); Lipidation (4); Modified residue (1); Sequence conflict (1); Turn (1) |
| Keywords | 3D-structure;Alternative splicing;Cell adhesion;Cell membrane;Direct protein sequencing;Endosome;Lipoprotein;Membrane;Myristate;Palmitate;Phosphoprotein;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}. Membrane, caveola {ECO:0000250}; Peripheral membrane protein {ECO:0000269|PubMed:9153235}. Endosome {ECO:0000250}. Membrane {ECO:0000250|UniProtKB:Q14254}; Lipid-anchor {ECO:0000250|UniProtKB:Q14254}. Note=Membrane-associated protein of caveolae. {ECO:0000250}. |
| Modified Residue | MOD_RES 405; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q14254 |
| Post Translational Modification | PTM: ZDHHC5-catalyzed palmitoylation may be required for the formation of higher-order complexes and for neurite outgrowth in cultured neural stem cells. {ECO:0000269|PubMed:22081607}. |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 1WIN; |
| Mapped Pubmed ID | 11167132; 11217851; 12466851; 12927782; 12967676; 14610273; 15602769; 15886206; 16635246; 16932745; 17416589; 17548467; 17600709; 17854803; 19144954; 19246642; 19298817; 19404397; 19458231; 19542222; 21059848; 21068336; 21187433; 21267068; 21677750; 22036569; 22056876; 23146906; 23174179; 24013648; 24046456; 24216609; 24287376; 24465508; 25105415; 26313572; 26496610; 27993509; 29686427; 29787576; 30452906; 31138766; 31455216; 6375655; |
| Motif | |
| Gene Encoded By | |
| Mass | 47,038 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |