Detail Information for IndEnz0002004653
IED ID IndEnz0002004653
Enzyme Type ID protease004653
Protein Name Serine protease inhibitor Kazal-type 13
Gene Name Spink13
Organism Rattus norvegicus (Rat)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat)
Enzyme Sequence MTRRGCWPHRIIFSLILLTWTHVTLAALIRSHTFSNWPKPPCKMYYPIDPDYEANCPDVIALVCATNGLNYKNECFFCIDRWEFGPHIEFVKYGKCE
Enzyme Length 97
Uniprot Accession Number D3ZVP0
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: May be a serine protease inhibitor (By similarity). Essential for sperm maturation and fertility. Inhibits sperm acrosome reaction, protecting sperm from premature reaction. {ECO:0000250, ECO:0000269|PubMed:23430248}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Disulfide bond (3); Domain (1); Signal peptide (1); Site (1)
Keywords Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal
Interact With
Induction INDUCTION: Up-regulated by testosterone. {ECO:0000269|PubMed:23430248}.
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:23430248}. Note=Secreted into the lumen of the initial segment of the epididymis and binds to sperm. In the initial segment of epididymis, localizes on the dorsal surface of the acrosomal region of sperm, gradually becomes more restricted to the acrosomal region in spermatozoa during epididymal transit.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..26; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 11,415
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda