| IED ID | IndEnz0002004657 |
| Enzyme Type ID | protease004657 |
| Protein Name |
Serine protease inhibitor Kazal-type 1 Pancreatic secretory trypsin inhibitor |
| Gene Name | SPINK1 PSTI |
| Organism | Monodelphis domestica (Gray short-tailed opossum) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Metatheria Didelphimorphia Didelphidae (opossums) Didelphinae Monodelphis (short-tailed opossums) Monodelphis domestica (Gray short-tailed opossum) |
| Enzyme Sequence | DQGRDANCNYEFPGCPRNLEPVCGTDGNTYNNECLLCMENKKRDVPIRIQKDGPC |
| Enzyme Length | 55 |
| Uniprot Accession Number | P81635 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens. {ECO:0000250|UniProtKB:P09036}.; FUNCTION: In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. {ECO:0000250|UniProtKB:P09036}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P09036}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,206 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |