| IED ID | IndEnz0002004658 |
| Enzyme Type ID | protease004658 |
| Protein Name |
Mitochondrial inner membrane protease subunit 2 EC 3.4.21.- |
| Gene Name | SPBC336.13c |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota Taphrinomycotina Schizosaccharomycetes Schizosaccharomycetales Schizosaccharomycetaceae Schizosaccharomyces Schizosaccharomyces pombe (Fission yeast) Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) |
| Enzyme Sequence | MANPFVRNQSFKSVFFKNLVGITLWVPVLMFVEQHVVSVGTIEGRSMKPAFNPETNMLQRDRVLLWKWNKDYKRGDVVILRSPENPEELLVKRVLGVEYDIMKTRPPKKLSLVPVPEGHVWVEGDEQFHSIDSNKFGPVSTGLITAKVIAILFPFSRAGRIDHEGFRKNAVFLSGKRSVK |
| Enzyme Length | 180 |
| Uniprot Accession Number | Q9UST2 |
| Absorption | |
| Active Site | ACT_SITE 46; /evidence=ECO:0000250; ACT_SITE 92; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Transmembrane (1) |
| Keywords | Hydrolase;Membrane;Mitochondrion;Mitochondrion inner membrane;Protease;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 18665268; 20473289; 23697806; 23950735; 25452419; 27558664; 27918601; 28410370; 30647105; 34250083; |
| Motif | |
| Gene Encoded By | |
| Mass | 20,546 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |