| IED ID | IndEnz0002004660 |
| Enzyme Type ID | protease004660 |
| Protein Name |
Protease B inhibitor 1 Proteinase inhibitor I B 1 |
| Gene Name | PBI2 YNL015W |
| Organism | Saccharomyces cerevisiae (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) |
| Enzyme Sequence | MTKNFIVTLKKNTPDVEAKKFLDSVHHAGGSIVHKFDIIKGYTIKVPDVLHLNKLKEKHNDVIENVEEDKEVHTN |
| Enzyme Length | 75 |
| Uniprot Accession Number | P0CT05 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cytosolic inhibitor of vacuolar proteinase B (yscB), probably regulating protease B activity during limited proteolysis. PBI2 is a component of the LMA1 complex, which is involved in the facilitation of vesicle fusion such as homotypic vacuole and ER-derived COPII vesicle fusion with the Golgi (By similarity). {ECO:0000250, ECO:0000269|PubMed:2015812}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Initiator methionine (1); Modified residue (1) |
| Keywords | Cytoplasm;Direct protein sequencing;Nucleus;Phosphoprotein;Protease inhibitor;Protein transport;Serine protease inhibitor;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:1100120}. Nucleus {ECO:0000250}. |
| Modified Residue | MOD_RES 74; /note=Phosphothreonine; /evidence=ECO:0000250|UniProtKB:P0CT04 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,589 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |