Detail Information for IndEnz0002004692
IED ID IndEnz0002004692
Enzyme Type ID protease004692
Protein Name Bradykinin-potentiating and C-type natriuretic peptides isoform 2
BPP-CNP

Cleaved into: Bradykinin-potentiating peptide 10a
BPP-10a
; Bradykinin-potentiating peptide 6a
BPP-6a
; Bradykinin-potentiating peptide 13a
BPP-13a
Bradykinin-potentiating peptide XIIIa
BPP-XIIIa
; Bradykinin-potentiating peptide 10c
BPP-10c
BPP-2
Bradykinin-potentiating peptide Xc
BPP-Xc
; Bradykinin-potentiating peptide 10c-F
BPP-10c-F
; Bradykinin-potentiating peptide 11b
BPP-11b
; Bradykinin-potentiating peptide AP
BPP-AP
; Bradykinin-potentiating peptide 11e
BPP-11e
Bradykinin-potentiating peptide XIe
BPP-XIe
; Bradykinin-potentiating peptide 5a
BPP-5a
Bradykinin-potentiating peptide Va
BPPVa

Fragment
Gene Name
Organism Bothrops jararacussu (Jararacussu)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Bothrops Bothrops jararacussu (Jararacussu)
Enzyme Sequence MVLSRLAASGLLLLALLALSVDGKPVQQWAQSWPGPNIPQLLVQQWAQGGWPRPGPEIPPLTVQQWAQNWPHPQIPPLTVQQWAQGRPPGPPIPPLTVQQWAQARPPHPPIPPAPLQKWAPVQKWAPVQKWAPVQKWAPLLQPT
Enzyme Length 144
Uniprot Accession Number Q7T1M3
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: [Bradykinin-potentiating peptide 10c]: Peptide with several activities. It inhibits the activity of the angiotensin-converting enzyme (ACE) by a preferential interaction with its C-domain (PubMed:11994001). It evokes transient hypotension (-14 mmHg) similar to that evoked by 0,5 ug of bradykinin, when injected alone into rats. It has a high bradykinin-potentiating effect (120%), when 60 nmol of BPP-10c are coinjected with 0.5 ug of bradykinin into rats (PubMed:22869554). Does not affect angiotensin-1 pressor effects. Shows potent and long-lasting antihypertensive activity as well as a reduction of the heart rate (PubMed:17475904). It also binds and dose-dependently promotes the activation of cytosolic argininosuccinate synthase (ASS1), an enzyme that catalyzes the conversion of citrulline, L-aspartate and ATP to argininosuccinate, AMP and pyrophosphate. It also enhances ASS1-dependent arginine production in HEK 293 cells, as well as in spontaneous hypertensive rat (SHR) and Wistar rat plasma. In addition, it induces the production of nitric-oxide (NO) by HUVEC cells via the endothelial nitric-oxide synthase (NOS3), which use arginine as a substrate and produce NO. It has been shown to be internalized by ASS1-expressing endothelial (HUVEC) and kidney (HEK 293) cells, and is detected homogenously distributed within the cell cytoplasm for up to 2 hours (PubMed:19491403). {ECO:0000269|PubMed:11994001, ECO:0000269|PubMed:17475904, ECO:0000269|PubMed:19491403, ECO:0000269|PubMed:22869554}.; FUNCTION: [Bradykinin-potentiating peptide 11e]: Acts as indirect hypotensive agent. Increases leukocyte rolling flux and adhesion by five-fold in post-capillary venules, without any increments in vasodilation of arterioles.; FUNCTION: [Bradykinin-potentiating peptide AP]: Acts as indirect hypotensive agent. Potently induces vasodilation of arterioles, with only a small increase in leukocyte rolling flux.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Modified residue (7); Mutagenesis (5); Non-terminal residue (1); Peptide (10); Propeptide (8); Region (1); Signal peptide (1)
Keywords Cytoplasm;Direct protein sequencing;Hypotensive agent;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Pyrrolidone carboxylic acid;Secreted;Signal;Toxin;Vasoactive
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:15912471, ECO:0000269|PubMed:18200607, ECO:0000269|PubMed:18400032}. Cytoplasm, cytosol. Note=BPP-10c is internalized in the cytosol of prey cells.
Modified Residue MOD_RES 31; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000250|UniProtKB:Q6LEM5"; MOD_RES 48; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000269|PubMed:15912471, ECO:0000269|PubMed:18200607"; MOD_RES 68; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000269|PubMed:15912471"; MOD_RES 85; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000269|PubMed:15912471"; MOD_RES 103; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000269|PubMed:15912471, ECO:0000269|PubMed:18400032"; MOD_RES 117; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000250|UniProtKB:P68515"; MOD_RES 123; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000250|UniProtKB:P68515"
Post Translational Modification
Signal Peptide SIGNAL 1..23; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 15,982
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda