| IED ID | IndEnz0002004694 |
| Enzyme Type ID | protease004694 |
| Protein Name |
Beta carbonic anhydrase 4 AtbCA4 AtbetaCA4 EC 4.2.1.1 Beta carbonate dehydratase 4 |
| Gene Name | BCA4 CA4 At1g70410 F17O7.5 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MAPAFGKCFMFCCAKTSPEKDEMATESYEAAIKGLNDLLSTKADLGNVAAAKIKALTAELKELDSSNSDAIERIKTGFTQFKTEKYLKNSTLFNHLAKTQTPKFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMVPPFDQKRHSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMSIEDDAAPTQSDFIENWVKIGASARNKIKEEHKDLSYDDQCNKCEKEAVNVSLGNLLSYPFVRAEVVKNTLAIRGGHYNFVKGTFDLWELDFKTTPAFAFS |
| Enzyme Length | 280 |
| Uniprot Accession Number | Q94CE4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=H(+) + hydrogencarbonate = CO2 + H2O; Xref=Rhea:RHEA:10748, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:16526, ChEBI:CHEBI:17544; EC=4.2.1.1; Evidence={ECO:0000269|PubMed:20010812}; |
| DNA Binding | |
| EC Number | 4.2.1.1 |
| Enzyme Function | FUNCTION: Reversible hydration of carbon dioxide. Together with BCA1, involved in the CO(2) signaling pathway which controls gas-exchange between plants and the atmosphere by modulating stomatal development and movements. Promotes water use efficiency. {ECO:0000269|PubMed:20010812, ECO:0000269|PubMed:25043023}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Chain (1); Coiled coil (1); Erroneous initiation (1); Initiator methionine (1); Modified residue (4) |
| Keywords | Acetylation;Alternative splicing;Cell membrane;Coiled coil;Lyase;Membrane;Phosphoprotein;Reference proteome;S-nitrosylation;Zinc |
| Interact With | O49660 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:17407539, ECO:0000269|PubMed:20010812}; Peripheral membrane protein {ECO:0000269|PubMed:17407539, ECO:0000269|PubMed:20010812}. |
| Modified Residue | MOD_RES 57; /note=Phosphothreonine; /evidence=ECO:0000250|UniProtKB:P42737; MOD_RES 117; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P42737; MOD_RES 223; /note=S-nitrosocysteine; /evidence=ECO:0000250|UniProtKB:P27140; MOD_RES Q94CE4-2:2; /note=N-acetylalanine; /evidence=ECO:0007744|PubMed:22223895 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12169696; 12938931; 16262714; 18650403; 20736450; 21798944; 24211190; 26243620; 26764375; 26993617; 28627464; 32146566; |
| Motif | |
| Gene Encoded By | |
| Mass | 30,836 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:10748 |
| Cross Reference Brenda |