| IED ID | IndEnz0002004713 |
| Enzyme Type ID | protease004713 |
| Protein Name |
Gap junction alpha-8 protein Connexin-45.6 Cx45.6 |
| Gene Name | GJA8 |
| Organism | Gallus gallus (Chicken) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken) |
| Enzyme Sequence | MGDWSFLGNILEQVNEQSTVIGRVWLTVLFIFRILILGTAAELVWGDEQSDFVCNTQQPGCENVCYDEAFPISHIRLWVLQIIFVSTPSLVYFGHAVHHVRMEEKRKEREEAERRQQAEVDEEKLPLAPNQNKGNNPDGTKKFRLEGTLLRTYILHIIFKTLFEVGFIVGQYFLYGFRILPLYRCGRWPCPNLVDCFVSRPTEKTIFIMFMLVVAAVSLFLNLVEISHLILKRIRRALRRPAEEQMGEVPEKPLHAIAVSSIPKAKGYKLLEEEKPVSHYFPLTEVGVEPSPLPSAFNEFEEKIGMGPLEDLSRAFDERLPSYAQAKEPEEEKVKAEEEEEQEEEQQAPQEEPGVKKAEEEVVSDEVEGPSAPAELATDVRSLSRLSKASSRARSDDLTV |
| Enzyme Length | 400 |
| Uniprot Accession Number | P36381 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Structural component of eye lens gap junctions (PubMed:8049527). Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane (By similarity). Small molecules and ions diffuse from one cell to a neighboring cell via the central pore (PubMed:8049527). {ECO:0000250|UniProtKB:P55917, ECO:0000269|PubMed:8049527}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (4); Disulfide bond (3); Initiator methionine (1); Intramembrane (1); Modified residue (1); Mutagenesis (4); Region (2); Sequence conflict (3); Site (1); Topological domain (5); Transmembrane (4) |
| Keywords | Cell junction;Cell membrane;Disulfide bond;Gap junction;Membrane;Phosphoprotein;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | P28238 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:8049527}; Multi-pass membrane protein {ECO:0000250|UniProtKB:P55917}. Cell junction, gap junction {ECO:0000305|PubMed:8049527}. |
| Modified Residue | MOD_RES 364; /note="Phosphoserine; by CK2"; /evidence="ECO:0000269|PubMed:10702244, ECO:0000269|PubMed:11448971" |
| Post Translational Modification | PTM: Proteolytically cleaved by caspase-3 during lens development. {ECO:0000269|PubMed:11448971}.; PTM: Phosphorylated on Ser-364; which inhibits cleavage by caspase-3. {ECO:0000269|PubMed:10702244, ECO:0000269|PubMed:11448971}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15802270; 16931554; 17895360; 18649174; 19126675; 20395299; 21172802; 21454606; 22418432; 27143357; 29487175; 33180092; |
| Motif | |
| Gene Encoded By | |
| Mass | 45,616 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |