| IED ID | IndEnz0002004717 |
| Enzyme Type ID | protease004717 |
| Protein Name |
Chlorotoxin CTX ClTx Tozuleristide |
| Gene Name | |
| Organism | Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Leiurus Leiurus quinquestriatus (Egyptian scorpion) Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion) |
| Enzyme Sequence | MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR |
| Enzyme Length | 36 |
| Uniprot Accession Number | P45639 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This toxin binds to the surface of glioma cells, and inhibits their proliferation without having effects on normal brain cells. In this context, this toxin has been described as a chloride channel inhibitor (probably ClC-3/CLCN3) by causing its internalization via caveolae (PubMed:16520829). It has also been described to selectively interact with MMP2 (in complex with MT1-MMP (MMP14) and TIMP2), to inhibit its enzymatic activity and to decrease its presence at the cell surface (PubMed:12454020). {ECO:0000269|PubMed:12454020, ECO:0000269|PubMed:16520829, ECO:0000269|PubMed:8383429}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Disulfide bond (4); Helix (1); Peptide (1) |
| Keywords | 3D-structure;Chloride channel impairing toxin;Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Knottin;Metalloenzyme inhibitor;Metalloprotease inhibitor;Neurotoxin;Protease inhibitor;Secreted;Toxin;Voltage-gated chloride channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:8383429}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (2); X-ray crystallography (1) |
| Cross Reference PDB | 1CHL; 5L1C; 6ATW; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,005 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |