| IED ID | IndEnz0002004718 |
| Enzyme Type ID | protease004718 |
| Protein Name |
Neurotoxin BmK CT BmKCT Bm-12 BmKCL1 CT neurotoxin Chlorotoxin-like Short-chain toxin KCT TXCL1 |
| Gene Name | |
| Organism | Mesobuthus martensii (Manchurian scorpion) (Buthus martensii) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Mesobuthus Mesobuthus martensii (Manchurian scorpion) (Buthus martensii) |
| Enzyme Sequence | MKFLYGIVFIALFLTVMFATQTDGCGPCFTTDANMARKCRECCGGIGKCFGPQCLCNRI |
| Enzyme Length | 59 |
| Uniprot Accession Number | Q9UAD0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Toxin with unknown function in healthy organisms. On glioma cells, inhibits chloride currents in a voltage-dependent manner (when tested on gliomas cells) (PubMed:17166663). Also interacts with MMP2 and significantly inhibits its catalytic activity (PubMed:21424168). May be internalized with chloride channels (probably ClC-3/CLCN3) and MMP2, thus inhibiting the chloride channels necessary for cell shrinkage and tumor propagation. {ECO:0000269|PubMed:17166663, ECO:0000269|PubMed:21424168}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (4); Mutagenesis (4); Signal peptide (1); Site (3) |
| Keywords | Chloride channel impairing toxin;Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Knottin;Metalloenzyme inhibitor;Metalloprotease inhibitor;Neurotoxin;Pharmaceutical;Protease inhibitor;Secreted;Signal;Toxin;Voltage-gated chloride channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:22887697}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000269|PubMed:22887697 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,467 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |