| IED ID | IndEnz0002004719 |
| Enzyme Type ID | protease004719 |
| Protein Name |
Cell wall protein CWP1 Glycoprotein GP40 |
| Gene Name | CWP1 YKL096W YJU1 YKL443 |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MKFSTALSVALFALAKMVIADSEEFGLVSIRSGSDLQYLSVYSDNGTLKLGSGSGSFEATITDDGKLKFDDDKYAVVNEDGSFKEGSESDAATGFSIKDGHLNYKSSSGFYAIKDGSSYIFSSKQSDDATGVAIRPTSKSGSVAADFSPSDSSSSSSASASSASASSSTKHSSSIESVETSTTVETSSASSPTASVISQITDGQIQAPNTVYEQTENAGAKAAVGMGAGALAVAAAYLL |
| Enzyme Length | 239 |
| Uniprot Accession Number | P28319 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the cell wall. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Lipidation (1); Natural variant (1); Propeptide (1); Region (1); Repeat (1); Sequence conflict (10); Signal peptide (1); Site (1) |
| Keywords | Cell wall;Direct protein sequencing;GPI-anchor;Glycoprotein;Lipoprotein;Membrane;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Positively regulated by cell integrity signaling through MPK1 in response to cell wall perturbation. Induction is dependent on transcription factor RLM1. Down-regulated during anaerobic growth. Up-regulated by low pH. {ECO:0000269|PubMed:10594829, ECO:0000269|PubMed:11016834, ECO:0000269|PubMed:11136466, ECO:0000269|PubMed:11292809}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall. Membrane; Lipid-anchor, GPI-anchor. Note=Identified as covalently-linked GPI-modified cell wall protein (GPI-CWP) as well as protein covalently linked via an alkali-sensitive bond not requiring the GPI-derived structure. Can also be double-anchored to the cell wall through both types of linkages. Incorporated into the birth scar of a daughter cell. |
| Modified Residue | |
| Post Translational Modification | PTM: Extensively O-glycosylated. {ECO:0000269|PubMed:7768807}.; PTM: The GPI-anchor is attached to the protein in the endoplasmic reticulum and serves to target the protein to the cell surface. There, the glucosamine-inositol phospholipid moiety is cleaved off and the GPI-modified mannoprotein is covalently attached via its lipidless GPI glycan remnant to the 1,6-beta-glucan of the outer cell wall layer.; PTM: Covalently linked to beta-1,3-glucan of the inner cell wall layer via an alkali-sensitive ester linkage between the gamma-carboxyl group of glutamic acids, arising from a specific glutamine within the PIR1/2/3 repeat, and hydroxyl groups of glucoses of beta-1,3-glucan chains (By similarity). The alkali-sensitive linkage is induced by low pH. {ECO:0000250}. |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000269|PubMed:7768807 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10672173; 10855497; 12483584; 15165243; 15470094; 15470095; 15563204; 15896991; 16429126; 16498706; 17305427; 17447102; 18281714; 18756268; 18854577; 18985283; 19053375; 19220866; 19536198; 20602336; 22652839; 22782902; 23135325; 24391512; 25154658; 25165136; 26113493; 26270963; 26386067; 26721269; 27510749; 9023939; 9335273; 9627960; 9758839; 9878836; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,268 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |