| IED ID | IndEnz0002004781 |
| Enzyme Type ID | protease004781 |
| Protein Name |
CRP-like protein Clp Catabolite activation-like protein CAP-like |
| Gene Name | clp XCC0472 |
| Organism | Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Xanthomonadales Xanthomonadaceae Xanthomonas Xanthomonas campestris Xanthomonas campestris pv. campestris Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) |
| Enzyme Sequence | MSLGNTTVVTTTVRNATPSLTLDAGTIERFLAHSHRRRYPTRTDVFRPGDPAGTLYYVISGSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREVILRTRTQCELAEISYERLQQLFQTSLSPDAPRILYAIGVQLSKRLLDTTRKASRLAFLDVTDRIVRTLHDLSKEPEAMSHPQGTQLRVSRQELARLVGCSREMAGRVLKKLQADGLLHARGKTVVLYGTR |
| Enzyme Length | 230 |
| Uniprot Accession Number | P22260 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Allosterically inhibited by cyclic di-GMP (c-di-GMP), which binds to Clp and abolishes its ability to bind its target gene promoter. {ECO:0000269|PubMed:20004667, ECO:0000269|PubMed:20008070}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 190..209; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00387 |
| EC Number | |
| Enzyme Function | FUNCTION: Global transcriptional regulator that regulates virulence factors production by activating or repressing the expression of a large set of genes in diffusible signal factor (DSF) pathway. It includes, among others, genes involved in extracellular polysaccharide (EPS) synthesis, flagellum synthesis, protein and fatty acid metabolism, multidrug resistance, iron uptake or genes encoding extracellular enzymes, membrane components and a few transcription factors. Regulation can be direct or indirect, via regulation of other transcriptional regulators. Not involved in DSF-mediated biofilm dispersal. {ECO:0000269|PubMed:17378922}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 18..139; /note=cNMP |
| Features | Beta strand (12); Chain (1); DNA binding (1); Domain (1); Helix (8); Mutagenesis (9); Nucleotide binding (1); Sequence conflict (4); Turn (1) |
| Keywords | 3D-structure;Activator;Allosteric enzyme;Cytoplasm;DNA-binding;Reference proteome;Repressor;Transcription;Transcription regulation;Virulence;c-di-GMP |
| Interact With | |
| Induction | INDUCTION: Expression is induced by DSF signal, via the RpfC/RpfG two-component system. {ECO:0000269|PubMed:17378922}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 3IWZ; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,711 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |