| IED ID | IndEnz0002004782 |
| Enzyme Type ID | protease004782 |
| Protein Name |
Degradation enzyme regulation protein DegQ Regulatory factor SacQ |
| Gene Name | degQ sacQ |
| Organism | Bacillus amyloliquefaciens (Bacillus velezensis) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus amyloliquefaciens group Bacillus amyloliquefaciens (Bacillus velezensis) |
| Enzyme Sequence | MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS |
| Enzyme Length | 46 |
| Uniprot Accession Number | P06532 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Stimulates the phosphotransfer from phospho-DegS to DegU (By similarity). Affects protease and levansucrose production. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,532 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |