| IED ID | IndEnz0002004821 |
| Enzyme Type ID | protease004821 |
| Protein Name |
Ligand-dependent corepressor LCoR Mblk1-related protein 2 |
| Gene Name | Lcor Kiaa1795 Mlr2 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MQRMIQQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCASSTSLSHSPGCSSTQGNGRPGRPSQYRPDGLRSGDGVPPRSLQDGTREGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGLQNHGQHLILSREASWAKPHYEFSLSRMKFRGNGALSNISDLPFLAENSAFPKMAHQTKQDGKRDMSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVMGSQTESALSKKLRAILPKQNRKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDPQGEAAQSANESKTE |
| Enzyme Length | 433 |
| Uniprot Accession Number | Q6ZPI3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 368..388; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00320 |
| EC Number | |
| Enzyme Function | FUNCTION: Repressor of ligand-dependent transcription activation by various nuclear repressors. Repressor of ligand-dependent transcription activation by ESR1, ESR2, NR3C1, PGR, RARA, RARB, RARG, RXRA and VDR (By similarity). May act as transcription activator that binds DNA elements with the sequence 5'-CCCTATCGATCGATCTCTACCT-3'. {ECO:0000250, ECO:0000269|PubMed:12560079}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (4); Cross-link (2); DNA binding (1); Domain (1); Erroneous initiation (1); Frameshift (1); Modified residue (3); Motif (2); Region (3); Sequence conflict (2) |
| Keywords | Activator;DNA-binding;Isopeptide bond;Nucleus;Phosphoprotein;Reference proteome;Repressor;Transcription;Transcription regulation;Ubl conjugation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00320}. |
| Modified Residue | MOD_RES 42; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q96JN0; MOD_RES 63; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q96JN0; MOD_RES 249; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q96JN0 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10512203; 11217851; 12466851; 12520002; 12904583; 14610273; 15618518; 15741177; 15840001; 17392792; 18799693; 19389355; 20059953; 20412781; 20436479; 21267068; 21677750; 22988430; 24952961; 25366156; 28530657; 28972158; 29453333; 29463649; 29628311; 29663375; |
| Motif | MOTIF 53..57; /note=Interaction with nuclear receptors; /evidence=ECO:0000250; MOTIF 339..345; /note=Nuclear localization signal; /evidence=ECO:0000255 |
| Gene Encoded By | |
| Mass | 47,125 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |