Detail Information for IndEnz0002004897
IED ID IndEnz0002004897
Enzyme Type ID protease004897
Protein Name Chagasin
Gene Name cha
Organism Trypanosoma cruzi
Taxonomic Lineage cellular organisms Eukaryota Discoba Euglenozoa Kinetoplastea (kinetoplasts) Metakinetoplastina Trypanosomatida Trypanosomatidae Trypanosoma Schizotrypanum Trypanosoma cruzi
Enzyme Sequence MSHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMFTVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSERFTVYLKAN
Enzyme Length 110
Uniprot Accession Number Q966X9
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Tight-binding and reversible inhibitor of papain-like cysteine proteases. {ECO:0000269|PubMed:11719560}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Beta strand (10); Chain (1); Helix (2); Motif (1); Turn (4)
Keywords 3D-structure;Cytoplasmic vesicle;Protease inhibitor;Thiol protease inhibitor
Interact With Q9NBD4
Induction
Subcellular Location SUBCELLULAR LOCATION: Flagellar pocket {ECO:0000269|PubMed:11719560}. Cytoplasmic vesicle {ECO:0000269|PubMed:11719560}. Cell surface {ECO:0000269|PubMed:11719560}. Note=Flagellar pocket and cytoplasmic vesicles of trypomastigotes and to the cell surface of amastigotes.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D NMR spectroscopy (1); X-ray crystallography (7)
Cross Reference PDB 2FO8; 2H7W; 2NNR; 2NQD; 2OUL; 3CBJ; 3CBK; 3E1Z;
Mapped Pubmed ID 16490204; 17011790; 17502099; 17561110; 18515357; 19143838;
Motif MOTIF 29..33; /note=NPTTG motif
Gene Encoded By
Mass 12,040
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda