| IED ID | IndEnz0002004899 |
| Enzyme Type ID | protease004899 |
| Protein Name |
Complement factor B-like protease EC 3.4.21.- Cleaved into: Complement factor B-like protease Ba fragment; Complement factor B-like protease Bb fragment Fragment |
| Gene Name | |
| Organism | Gallus gallus (Chicken) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken) |
| Enzyme Sequence | ATTRCDPTLIPIAGGWFELLEGGEALRYRCPPGHIPTPLARRSCGPDGQXEPLXXXXXXXXXXXXXXXXKCRAVWCPPPQDMEHGSFWPRLPRYPPGSRLHFQCFQGFNLRGAPNRTCGEGGRWSGVTPVCDDGSGDCPAPPVXXXXXKEGSRYLLEDTVRFRCGPGLVLLGSAVRQCLEGGVWSGTEPQCRAPLSFDTPSDVAASFMASLSQSVERADSNSSHGPTEKLPRXIRVDGSAXLNVFLLXDA |
| Enzyme Length | 250 |
| Uniprot Accession Number | P81475 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Required in both the classical and alternate pathways of the complement system. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (3); Disulfide bond (6); Domain (3); Glycosylation (2); Non-terminal residue (1) |
| Keywords | Complement alternate pathway;Complement pathway;Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Immunity;Innate immunity;Protease;Reference proteome;Repeat;Secreted;Serine protease;Sushi |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 27,059 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |