| IED ID | IndEnz0002004902 |
| Enzyme Type ID | protease004902 |
| Protein Name |
Deubiquitinase and deneddylase Dub2 ChlaDub2 EC 3.4.22.- |
| Gene Name | cdu2 CTA_0947 |
| Organism | Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) |
| Taxonomic Lineage | cellular organisms Bacteria PVC group Chlamydiae Chlamydiia Chlamydiales Chlamydiaceae Chlamydia/Chlamydophila group Chlamydia Chlamydia trachomatis Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) |
| Enzyme Sequence | MEPIHNPPPQTCSYSRPSTTYTSFKDASCGTKVTRIIIALFLIVISCGLILCAYTFRDLLDADYSAQEGPQQATKLLQQLDKVLTGPPLPIWDNEHLFQFSCLMQNKHRRVLPIDICNPLTKFNFLEYICNCLMTKQSVNVNETDMCELFCPPTCTPENYRRLLCTSSVFPFVMWHDPSADTQEAMLTKMDQTMSSGRVGNSHWVLVIVDIEHRCVTFFDSFYNYIASPQQMREQLEGLAASLGAIYPKEGGADSDQEELLSPFQVRIGSTVKVQSPGEFTCGAWCCQFLAWYLENPDFDLEEKVPTNPSERRALLADFISTTEQAMSRYSSLSWPTTD |
| Enzyme Length | 339 |
| Uniprot Accession Number | Q3KKG9 |
| Absorption | |
| Active Site | ACT_SITE 203; /evidence=ECO:0000255; ACT_SITE 220; /evidence=ECO:0000255; ACT_SITE 282; /evidence=ECO:0000255 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues. This protease possesses deubiquitinating and deneddylating activities (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Transmembrane (1) |
| Keywords | Hydrolase;Membrane;Protease;Secreted;Thiol protease;Transmembrane;Transmembrane helix;Ubl conjugation pathway;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. Host cell {ECO:0000250}. Membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. Note=Secreted, and delivered into the host cell. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,410 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |