| IED ID | IndEnz0002004906 |
| Enzyme Type ID | protease004906 |
| Protein Name |
Death domain-containing protein CRADD Caspase and RIP adapter with death domain RIP-associated protein with a death domain |
| Gene Name | CRADD RAIDD |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE |
| Enzyme Length | 199 |
| Uniprot Accession Number | P78560 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Adapter protein that associates with PIDD1 and the caspase CASP2 to form the PIDDosome, a complex that activates CASP2 and triggers apoptosis (PubMed:9044836, PubMed:15073321, PubMed:16652156, PubMed:17159900, PubMed:17289572). Also recruits CASP2 to the TNFR-1 signaling complex through its interaction with RIPK1 and TRADD and may play a role in the tumor necrosis factor-mediated signaling pathway (PubMed:8985253). {ECO:0000269|PubMed:15073321, ECO:0000269|PubMed:16652156, ECO:0000269|PubMed:17159900, ECO:0000269|PubMed:17289572, ECO:0000269|PubMed:8985253, ECO:0000269|PubMed:9044836}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Beta strand (1); Chain (1); Domain (2); Helix (14); Mutagenesis (17); Natural variant (1); Turn (1) |
| Keywords | 3D-structure;Alternative splicing;Apoptosis;Cytoplasm;Disease variant;Mental retardation;Nucleus;Reference proteome |
| Interact With | P35609; Q8NEU8; Q8N3I7; P42575; Q7L273; Q9HB75; Q9BYV2; P14079 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:O88843}. Nucleus {ECO:0000250|UniProtKB:O88843}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (2) |
| Cross Reference PDB | 2O71; 2OF5; 3CRD; |
| Mapped Pubmed ID | 11156409; 16169070; 16183742; 16434054; 17329820; 18391951; 19125251; 19203584; 19582216; 20208132; 20237496; 20406701; 20546612; 20677014; 20935634; 21988832; 22458338; 22854598; 24958727; 25416956; 25528640; 27606466; 27773430; 28686357; 30914828; 33647455; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,745 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |