Detail Information for IndEnz0002004927
IED ID IndEnz0002004927
Enzyme Type ID protease004927
Protein Name Glycinin G5
Glycinin 11S G5
Glycinin A3B4
allergen Gly m 6

Cleaved into: Glycinin A3 subunit; Glycinin B4 subunit
Gene Name GY5 Glyma13g18450
Organism Glycine max (Soybean) (Glycine hispida)
Taxonomic Lineage cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen. Soja Glycine max (Soybean) (Glycine hispida)
Enzyme Sequence MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGSHLPSYLPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSRRGSRSQQQLQDSHQKIRHFNEGDVLVIPLGVPYWTYNTGDEPVVAISPLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHRQQEEEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYGRTPSYPPRRPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPDWNLNANSVTMTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNPAVAEQGGEQGLEYVVFKTHHNAVSSYIKDVFRVIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP
Enzyme Length 516
Uniprot Accession Number P04347
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Glycinin is the major seed storage protein of soybean (PubMed:2485233). Glycinin basic peptides (GBPs), and, to a lower extent, glycinin exhibit antibacterial activity against Gram-negative and Gram-positive bacteria (e.g. L.monocytogenes, B.subtilis, E.coli and S.enteritidis) by forming pores and aggregating in transmembranes, leading to membrane permeability and, eventually, cell death (PubMed:22236762, Ref.15, PubMed:28590128). {ECO:0000269|PubMed:22236762, ECO:0000269|PubMed:2485233, ECO:0000269|PubMed:28590128, ECO:0000269|Ref.15}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Alternative sequence (1); Beta strand (26); Chain (2); Compositional bias (2); Disulfide bond (2); Domain (2); Glycosylation (1); Helix (11); Region (3); Sequence conflict (57); Signal peptide (1); Turn (4)
Keywords 3D-structure;Allergen;Alternative splicing;Disulfide bond;Endoplasmic reticulum;Glycoprotein;Reference proteome;Seed storage protein;Signal;Storage protein;Vacuole
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Vacuole, aleurone grain. Endoplasmic reticulum {ECO:0000269|PubMed:29348620}. Protein storage vacuole {ECO:0000269|PubMed:29348620}. Note=Hexamers are assembled in the endoplasmic reticulum and later sorted to the protein storage vacuoles (PubMed:29348620). Cotyledonary membrane-bound vacuolar protein bodies. {ECO:0000269|PubMed:29348620}.
Modified Residue
Post Translational Modification PTM: During soybean germination, seed storage proteins are hydrolyzed by protease/26S proteasome. {ECO:0000269|PubMed:29037738}.
Signal Peptide SIGNAL 1..24; /evidence=ECO:0000255
Structure 3D X-ray crystallography (3)
Cross Reference PDB 1OD5; 2D5F; 2D5H;
Mapped Pubmed ID 20834138; 28592556;
Motif
Gene Encoded By
Mass 57,956
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda