| IED ID | IndEnz0002004932 |
| Enzyme Type ID | protease004932 |
| Protein Name |
Kunitz-type trypsin inhibitor alpha chain AKTI Fragments |
| Gene Name | |
| Organism | Albizia kalkora (Kalkora mimosa) (Mimosa kalkora) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Caesalpinioideae mimosoid clade Ingeae Albizia Albizia kalkora (Kalkora mimosa) (Mimosa kalkora) |
| Enzyme Sequence | KELLDADGDILRNGGPAYPGLMPGVERDLPASGWGLPRRTGDESCPLNVKAVR |
| Enzyme Length | 53 |
| Uniprot Accession Number | P85498 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin with a Ki of 0.25 uM. Inhibits the trypsin-like proteases in midguts of larval H.armigera, S.exigua, and P.rapae. {ECO:0000269|PubMed:18368297}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Retains almost 100% of its activity after heating for 10 minutes at 70 degrees Celsius, activity is lost rapidly above 70 degrees Celsius. {ECO:0000269|PubMed:18368297}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Stable from pH 2.0 to 12.0. {ECO:0000269|PubMed:18368297}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Non-adjacent residues (3); Non-terminal residue (1); Region (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,631 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |