| IED ID | IndEnz0002004963 |
| Enzyme Type ID | protease004963 |
| Protein Name |
Microtubule-associated proteins 1A/1B light chain 3 beta 2 Microtubule-associated proteins 1A/1B light chain 3B-like |
| Gene Name | MAP1LC3B2 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFGMKLSV |
| Enzyme Length | 125 |
| Uniprot Accession Number | A6NCE7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. In response to cellular stress and upon mitochondria fission, binds C-18 ceramides and anchors autophagolysosomes to outer mitochondrial membranes to eliminate damaged mitochondria. While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. {ECO:0000250|UniProtKB:Q9GZQ8}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Lipidation (2); Propeptide (1); Site (1) |
| Keywords | Autophagy;Cytoplasm;Cytoplasmic vesicle;Cytoskeleton;Lipoprotein;Membrane;Microtubule;Reference proteome;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasmic vesicle, autophagosome membrane {ECO:0000250|UniProtKB:Q9GZQ8}; Lipid-anchor {ECO:0000250|UniProtKB:Q9GZQ8}. Endomembrane system {ECO:0000250|UniProtKB:Q9GZQ8}; Lipid-anchor {ECO:0000250|UniProtKB:Q9GZQ8}. Cytoplasm, cytoskeleton {ECO:0000250|UniProtKB:Q9CQV6}. |
| Modified Residue | |
| Post Translational Modification | PTM: The precursor molecule is cleaved by ATG4 (ATG4A, ATG4B, ATG4C or ATG4D) to expose the glycine at the C-terminus and form the cytosolic form, LC3-I (PubMed:30661429). The processed form is then activated by APG7L/ATG7, transferred to ATG3 and conjugated to phosphatidylethanolamine (PE) phospholipid to form the membrane-bound form, LC3-II (By similarity). During non-canonical autophagy, the processed form is conjugated to phosphatidylserine (PS) phospholipid (By similarity). ATG4 proteins also mediate the delipidation of PE-conjugated forms (By similarity). In addition, ATG4B and ATG4D mediate delipidation of ATG8 proteins conjugated to PS during non-canonical autophagy (By similarity). {ECO:0000250|UniProtKB:Q9GZQ8, ECO:0000269|PubMed:30661429}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 19684603; 20562859; |
| Motif | |
| Gene Encoded By | |
| Mass | 14,628 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |