| IED ID | IndEnz0002004969 |
| Enzyme Type ID | protease004969 |
| Protein Name |
Protein DDI1 homolog 2 EC 3.4.23.- |
| Gene Name | ddi2 |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Otomorpha Ostariophysi Otophysi Cypriniphysae Cypriniformes (carps and others) Cyprinoidei Danionidae Danioninae Danio Danio rerio (Zebrafish) (Brachydanio rerio) |
| Enzyme Sequence | MLLTVFCAPRDRSETTFALDVSPELELRDFLALCELESGIPAGEIQIIYAEQPLQDPTRALGNYGLKDGDVLVLRQAERLRAPPQPTVPGLPRIDFSSIAVPGTSSGQNRNRPQQAQRPSTTQPPPPQATTSPGSGVSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLERFTKVLMEQQQDRARRDQERIKLLTADPFDLDAQAKIEEEIRQHNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEDQPMDMLLGLDMLKRHQCSIDLKKNVLLIGTTGTETRFLPEAELPECARLAYGPEGREEPRPDEIADRELAEAIQRSVQDSGKMHDM |
| Enzyme Length | 411 |
| Uniprot Accession Number | Q6TH22 |
| Absorption | |
| Active Site | ACT_SITE 262; /evidence=ECO:0000305 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.23.- |
| Enzyme Function | FUNCTION: Aspartic protease that mediates the cleavage of NFE2L1/NRF1 at 'Leu-104', thereby promoting release of NFE2L1/NRF1 from the endoplasmic reticulum membrane. Ubiquitination of NFE2L1/NRF1 is a prerequisite for cleavage, suggesting that DDI2 specifically recognizes and binds ubiquitinated NFE2L1/NRF1. Seems to act as a proteasomal shuttle which links the proteasome and replication fork proteins like RTF2. Required for cellular survival following replication stress. {ECO:0000250|UniProtKB:Q5TDH0}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Alternative sequence (1); Chain (1); Compositional bias (1); Domain (1); Motif (1); Region (1); Sequence conflict (2) |
| Keywords | Alternative splicing;Aspartyl protease;Chromosome;Cytoplasm;Hydrolase;Protease;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000250|UniProtKB:Q5TDH0}. Chromosome {ECO:0000250|UniProtKB:Q5TDH0}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 27528193; |
| Motif | MOTIF 387..406; /note=Ubiquitin-binding; /evidence=ECO:0000305 |
| Gene Encoded By | |
| Mass | 45,596 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |