| IED ID | IndEnz0002004971 |
| Enzyme Type ID | protease004971 |
| Protein Name |
Cystatin-C Colostrum thiol proteinase inhibitor Cystatin-3 |
| Gene Name | CST3 |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MVGSPRAPLLLLASLIVALALALAVSPAAAQGPRKGRLLGGLMEADVNEEGVQEALSFAVSEFNKRSNDAYQSRVVRVVRARKQVVSGMNYFLDVELGRTTCTKSQANLDSCPFHNQPHLKREKLCSFQVYVVPWMNTINLVKFSCQD |
| Enzyme Length | 148 |
| Uniprot Accession Number | P01035 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This is a thiol proteinase inhibitor. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Modified residue (1); Motif (1); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Pyrrolidone carboxylic acid;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 31; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:9434110 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..30; /evidence=ECO:0000305 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 84..88; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 16,265 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |