| IED ID | IndEnz0002004981 |
| Enzyme Type ID | protease004981 |
| Protein Name |
Equistatin EI Cysteine proteinase inhibitor |
| Gene Name | |
| Organism | Actinia equina (Beadlet anemone) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Actiniidae Actinia Actinia equina (Beadlet anemone) |
| Enzyme Sequence | MALSQNQAKFSKGFVVMIWVLFIACAITSTEASLTKCQQLQASANSGLIGAYVPQCKETGEFEEKQCWGSTGYCWCVDEDGKEILGTKIRGSPDCSRRKAALTLCQMMQAIIVNVPGWCGPPSCKADGSFDEVQCCASNGECYCVDKKGKELEGTRQQGRPTCERHLSECEEARIKAHSNSLRVEMFVPECFEDGSYNPVQCWPSTGYCWCVDEGGVKVPGSDVRFKRPTC |
| Enzyme Length | 231 |
| Uniprot Accession Number | P81439 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Potent inhibitor of papain-like cysteine proteinases (Ki=0.18-0.57 nM on papain), as well as of the aspartic proteinase cathepsin D (Ki=0.3-05 nM). {ECO:0000269|PubMed:10720485, ECO:0000269|PubMed:9153250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (9); Domain (3); Natural variant (7); Sequence conflict (6); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Repeat;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:9153250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..32; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,410 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |