| IED ID | IndEnz0002005006 |
| Enzyme Type ID | protease005006 |
| Protein Name |
Fetuin-B Fetuin-like protein IRL685 |
| Gene Name | Fetub |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MGLLRLLVLCTLAACCMARSPPAPPLPQRPLSPLHPLGCNDSEVLAVAGFALQNINRDQKDGYMLSLNRVHDVREHYQEDMGSLFYLTLDVLETDCHVLSRKAQKDCKPRMFYESVYGQCKAMFHINKPRRVLYLPAYNCTLRPVSKRKTHTTCPDCPSPIDLSNPSALEAATESLAKFNSKSPSKKYELVKVTKAMNQWVSGPAYYVEYLIKEAPCTKSQASCSLQHSDSEPVGICQGSTVQSSLRHVPLIQPVEKSVTVTCEFFESQAQVPGDENPAVTQGPQKLPQKNTAPTSSPSVTAPRGSIQHLPELDDEKPEESKGGSPEEAFPVQLDLTTNPQGDTLDVSFLYLEPGDKKLVVLPFPGKEQRSAECPGPEKENNPLVLPP |
| Enzyme Length | 388 |
| Uniprot Accession Number | Q9QXC1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Protease inhibitor required for egg fertilization. Required to prevent premature zona pellucida hardening before fertilization, probably by inhibiting the protease activity of ASTL, a protease that mediates the cleavage of ZP2 and triggers zona pellucida hardening. {ECO:0000269|PubMed:23562279}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (14); Chain (1); Compositional bias (2); Disulfide bond (5); Domain (2); Glycosylation (4); Helix (7); Modified residue (1); Region (2); Signal peptide (1); Turn (2) |
| Keywords | 3D-structure;Disulfide bond;Fertilization;Glycoprotein;Metalloenzyme inhibitor;Metalloprotease inhibitor;Phosphoprotein;Protease inhibitor;Reference proteome;Repeat;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:23562279}. |
| Modified Residue | MOD_RES 321; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q9UGM5 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 6HPV; 6HT9; 7AUW; |
| Mapped Pubmed ID | 11217851; 12466851; 12939278; 12943536; 15499407; 16602821; 21267068; 22988105; 25205729; 26603189; 26759143; 27733489; 28214129; 30189195; 30679641; 30867929; 31604990; 32147518; 33782129; |
| Motif | |
| Gene Encoded By | |
| Mass | 42,713 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |