| IED ID | IndEnz0002005017 |
| Enzyme Type ID | protease005017 |
| Protein Name |
Inducible serine protease inhibitor 2 ISPI-2 Fragment |
| Gene Name | |
| Organism | Galleria mellonella (Greater wax moth) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Amphiesmenoptera Lepidoptera (butterflies and moths) Glossata Neolepidoptera Heteroneura Ditrysia Obtectomera Pyraloidea Pyralidae (snout moths) Galleriinae Galleria Galleria mellonella (Greater wax moth) |
| Enzyme Sequence | LDPKCTLPLETGICRAELHRFGYDTKLKECTQFVYGGCHHNENNFKKLEVCR |
| Enzyme Length | 52 |
| Uniprot Accession Number | P81906 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin and the toxin protease PR2 of M.anisopliae. Does not inhibit chymotrypsin, subtilisin Carlsberg, proteinase K, porcine pancreatic elastase and the toxin protease PR1 of M.anisopliae. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Domain (1); Non-terminal residue (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Serine protease inhibitor |
| Interact With | |
| Induction | INDUCTION: By infection. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,057 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |