| IED ID | IndEnz0002005029 |
| Enzyme Type ID | protease005029 |
| Protein Name |
Integrin alpha-M CD11 antigen-like family member B CR-3 alpha chain Cell surface glycoprotein MAC-1 subunit alpha Leukocyte adhesion receptor MO1 CD antigen CD11b Fragment |
| Gene Name | ITGAM |
| Organism | Cavia porcellus (Guinea pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Hystricomorpha Caviidae (cavies) Cavia (guinea pigs) Cavia porcellus (Guinea pig) |
| Enzyme Sequence | QLELPVKYAVYLIVTSGEASTTYLNFTTSEKTIQTMKHQYKFTNLGKRSLPISVVFWVPVRLNNEIVWDRPQVTFSPNLSSACNTEERSPPHSDFLAELEKTHVLNCSIAVCQRIACDIPYFNIQE |
| Enzyme Length | 126 |
| Uniprot Accession Number | P11578 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Integrin ITGAM/ITGB2 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles. It is identical with CR-3, the receptor for the iC3b fragment of the third complement component. It probably recognizes the R-G-D peptide in C3b. Integrin ITGAM/ITGB2 is also a receptor for fibrinogen, factor X and ICAM1. It recognizes P1 and P2 peptides of fibrinogen gamma chain. Regulates neutrophil migration. In association with beta subunit ITGB2/CD18, required for CD177-PRTN3-mediated activation of TNF primed neutrophils. May regulate phagocytosis-induced apoptosis in extravasated neutrophils. May play a role in mast cell development. Required with TYROBP/DAP12 in microglia to control production of microglial superoxide ions which promote the neuronal apoptosis that occurs during brain development. {ECO:0000250|UniProtKB:P05555, ECO:0000250|UniProtKB:P11215}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Glycosylation (3); Non-terminal residue (2) |
| Keywords | Cell adhesion;Cell membrane;Glycoprotein;Integrin;Membrane;Receptor;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250|UniProtKB:P11215}; Single-pass type I membrane protein {ECO:0000250|UniProtKB:P11215}. Membrane raft {ECO:0000250|UniProtKB:P11215}; Single-pass type I membrane protein {ECO:0000250|UniProtKB:P11215}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,411 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |