| IED ID | IndEnz0002005032 |
| Enzyme Type ID | protease005032 |
| Protein Name |
Inhibitor of toxin/antitoxin system Gene product 4.5 Gp4.5 |
| Gene Name | 4.5 |
| Organism | Escherichia phage T7 (Bacteriophage T7) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Autographiviridae Studiervirinae Teseptimavirus Escherichia virus T7 Escherichia phage T7 (Bacteriophage T7) |
| Enzyme Sequence | MSNVAETIRLSDTADQWNRRVHINVRNGKATMVYRWKDSKSSKNHTQRMTLTDEQALRLVNALTKAAVTAIHEAGRVNEAMAILDKIDN |
| Enzyme Length | 89 |
| Uniprot Accession Number | P03785 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Plays a role in the inhibition of the host toxin-antitoxin (TA) system. These modules made by the host and composed of a toxic gene and a neutralizing gene play role in stress response and programmed cell death. Gp4.5 interacts with the host protease lon to neutralize the degradation of the antitoxin that would result in the activation of the toxin and the destruction of the bacteria. {ECO:0000269|PubMed:23478446}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Host-virus interaction;Reference proteome;Toxin-antitoxin system |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 8528255; |
| Motif | |
| Gene Encoded By | |
| Mass | 10,091 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |