| IED ID | IndEnz0002005034 |
| Enzyme Type ID | protease005034 |
| Protein Name |
Protein K3 Protein K2 |
| Gene Name | VACWR034 K2L K3L |
| Organism | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
| Enzyme Sequence | MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ |
| Enzyme Length | 88 |
| Uniprot Accession Number | P18378 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. {ECO:0000269|PubMed:8099586}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Domain (1); Helix (2); Turn (1) |
| Keywords | 3D-structure;Host-virus interaction;Inhibition of host PKR by virus;Inhibition of host innate immune response by virus;Inhibition of host interferon signaling pathway by virus;RNA-binding;Reference proteome;Viral immunoevasion |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1LUZ; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 10,556 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |