| IED ID | IndEnz0002005045 |
| Enzyme Type ID | protease005045 |
| Protein Name |
Allergen Api m 6.03 / Api m 6.04 allergen Api m 6 Cleaved into: Allergen Api m 6.01 / Api m 6.02 |
| Gene Name | |
| Organism | Apis mellifera (Honeybee) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Hymenoptera Apocrita (wasps ants and bees) Aculeata Apoidea (bees) Apidae (bumble bees and honey bees) Apinae (honey bees) Apini Apis Apis mellifera (Honeybee) |
| Enzyme Sequence | MSRLVLASFLLLAIFSMLVGGFGGFGGFGGLGGRGKCPSNEIFSRCDGRCQRFCPNVVPKPLCIKICAPGCVCRLGYLRNKKKVCVPRSKCG |
| Enzyme Length | 92 |
| Uniprot Accession Number | P83563 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May act as a protease inhibitor. {ECO:0000305|PubMed:23397669}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Disulfide bond (5); Domain (1); Natural variant (1); Sequence conflict (1); Signal peptide (1); Site (1) |
| Keywords | Allergen;Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:11344362}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,819 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |