| IED ID | IndEnz0002005078 |
| Enzyme Type ID | protease005078 |
| Protein Name |
Putative zinc protease AlbF EC 3.4.24.- Antilisterial bacteriocin subtilosin biosynthesis protein AlbF |
| Gene Name | albF |
| Organism | Bacillus subtilis |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis |
| Enzyme Sequence | MEKKAFFQQLDERTDIRYTDSGMKIIRLKFPRAHLRLCNVKIDFGSRDVCLQAESGDTLLPYGTAHFLEHLLFWHNGRNLYTDFFAHGALLNAFTTYTDTNFMFTSLPDRLRQTIPILLDALWNHSFDKKMITQEKAVITSEIQTAHLNHQLYYHYQLISMLSPASPAAVFPAGRIEDIEALDIRDLQKAYNAAYQPQRMTLFLIGGSEDTEALLPPHLRLEKRPNHKAERKIISACPPPALSQKMVLGNEERIEDTWTGLQVGAIPGQNNLLTLKLYWDIASRILFQLDSPFFQEIQQTYRLEIDCLSAEAHMYEDGGFLILHSQGAHSSAYIDVASYYVTQQKQQIETWLQYGKDSLTDAIIYDSDYVRKCFEWAAECDRCDCTFLDMYRIIHDMNSQDFLSLIDALASSKKAVIHVSQKEAIGQ |
| Enzyme Length | 427 |
| Uniprot Accession Number | Q8RKH2 |
| Absorption | |
| Active Site | ACT_SITE 69; /note=Proton acceptor; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Required for production of the bacteriocin subtilosin. Could catalyze some step in the processing of presubtilosin (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Metal binding (3) |
| Keywords | Antibiotic biosynthesis;Bacteriocin biosynthesis;Hydrolase;Metal-binding;Metalloprotease;Protease;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 49,068 |
| Kinetics | |
| Metal Binding | METAL 66; /note=Zinc; /evidence=ECO:0000250; METAL 70; /note=Zinc; /evidence=ECO:0000250; METAL 142; /note=Zinc; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |