| IED ID | IndEnz0002005098 |
| Enzyme Type ID | protease005098 |
| Protein Name |
Caspase recruitment domain-containing protein 16 Caspase recruitment domain-only protein 1 CARD-only protein 1 Caspase-1 inhibitor COP Pseudo interleukin-1 beta converting enzyme Pseudo-ICE Pseudo-IL1B-converting enzyme |
| Gene Name | CARD16 COP COP1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDAQRIWKQKLQRCHVQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNILLLPLHKGSLYPRIPGLGKELQTGTHKLS |
| Enzyme Length | 197 |
| Uniprot Accession Number | Q5EG05 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Caspase inhibitor. Acts as a regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-interleukin-1 beta (IL1B) and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. Also induces NF-kappa-B activation during the pro-inflammatory cytokine response. Also able to inhibit CASP1-mediated neuronal cell death, TNF-alpha, hypoxia-, UV-, and staurosporine-mediated cell death but not ER stress-mediated cell death. Acts by preventing activation of caspases CASP1 and CASP4, possibly by preventing the interaction between CASP1 and RIPK2. {ECO:0000269|PubMed:11432859, ECO:0000269|PubMed:11536016, ECO:0000269|PubMed:16920334}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Chain (1); Domain (1); Natural variant (4) |
| Keywords | Alternative splicing;Protease inhibitor;Reference proteome;Thiol protease inhibitor |
| Interact With | |
| Induction | INDUCTION: Down-regulated in patients suffering of Huntington disease. {ECO:0000269|PubMed:16354923}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 19913121; 20628086; 25311538; 26521743; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,625 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |