| IED ID | IndEnz0002005101 |
| Enzyme Type ID | protease005101 |
| Protein Name |
Carbohydrate-binding protein AQN-3 Spermadhesin AQN-3 Zona pellucida-binding protein AQN-3 |
| Gene Name | |
| Organism | Sus scrofa (Pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig) |
| Enzyme Sequence | AQNKGSDDCGGFLKNYSGWISYYKALTTNCVWTIEMKPGHKIILQILPLNLTCGKEYLEVRDQRAGPDNFLKVCGGTGFVYQSSHNVATVKYSRDSHHPASSFNVYFYGIPQGAKA |
| Enzyme Length | 116 |
| Uniprot Accession Number | P24020 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: AQN proteins mediate the binding of boar spermatozoa to component(s) of the egg's zona pellucida by a carbohydrate-binding mechanism. AQN proteins are secretory components of the male accessory glands being coated to the sperm surface at the time of ejaculation. They possess as well heparin-, serine-protease-inhibitor-binding capability. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Domain (1); Glycosylation (1); Modified residue (1); Sequence conflict (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Fertilization;Glycoprotein;Heparin-binding;Methylation;Reference proteome;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 85; /note=Methylhistidine; /evidence=ECO:0000305|PubMed:1936247 |
| Post Translational Modification | PTM: The residue at position 85 was identified as a methylhistidine by mass spectrometry. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,885 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |