| IED ID | IndEnz0002005138 |
| Enzyme Type ID | protease005138 |
| Protein Name |
Baculoviral IAP repeat-containing protein 5 Apoptosis inhibitor survivin |
| Gene Name | BIRC5 |
| Organism | Cavia porcellus (Guinea pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Hystricomorpha Caviidae (cavies) Cavia (guinea pigs) Cavia porcellus (Guinea pig) |
| Enzyme Sequence | MGAPSLPRAWQLYLKEHRVSTFKNWPFVNGCSCTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHKKHSSGCAFLSVKKQFEELTLSEFLKLDKERAKNKIAKETNSKQKEFEETAAKVRQAMEQLAALE |
| Enzyme Length | 142 |
| Uniprot Accession Number | E3SCZ8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis (PubMed:20727954, PubMed:21364656, PubMed:20627126). Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis (PubMed:20727954). Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules (By similarity). Involved in the recruitment of CPC to centromeres during early mitosis via association with histone H3 phosphorylated at 'Thr-3' (H3pT3) during mitosis (By similarity). The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules (By similarity). May counteract a default induction of apoptosis in G2/M phase (By similarity). The acetylated form represses STAT3 transactivation of target gene promoters (By similarity). May play a role in neoplasia. Inhibitor of CASP3 and CASP7 (By similarity). Essential for the maintenance of mitochondrial integrity and function (By similarity). {ECO:0000250|UniProtKB:O15392, ECO:0000269|PubMed:20627126, ECO:0000269|PubMed:20727954, ECO:0000269|PubMed:21364656}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Metal binding (4); Modified residue (9); Mutagenesis (3); Repeat (1); Site (1) |
| Keywords | Acetylation;Apoptosis;Cell cycle;Cell division;Centromere;Chromosome;Chromosome partition;Cytoplasm;Cytoskeleton;Kinetochore;Metal-binding;Microtubule;Mitosis;Nucleus;Phosphoprotein;Protease inhibitor;Reference proteome;Repressor;Stress response;Thiol protease inhibitor;Transcription;Transcription regulation;Ubl conjugation;Zinc |
| Interact With | |
| Induction | INDUCTION: Expression is up-regulated in the spiral ligament and nerve fibers of the cochlea upon moderate noise exposure causing only a temporary hearing impairment. Expression is down-regulated in the organ of Corti, the spiral ganglion, the stria vascularis and the spiral ligament of the cochlea upon intratympanic injection of aminoglycoside antibiotic gentamicin inducing cell damage and permanent hearing loss. {ECO:0000269|PubMed:20627126, ECO:0000269|PubMed:21364656}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:20627126, ECO:0000269|PubMed:20727954, ECO:0000269|PubMed:21364656}. Nucleus {ECO:0000269|PubMed:20627126, ECO:0000269|PubMed:20727954, ECO:0000269|PubMed:21364656}. Chromosome {ECO:0000250|UniProtKB:O15392}. Chromosome, centromere {ECO:0000269|PubMed:20727954}. Cytoplasm, cytoskeleton, spindle {ECO:0000269|PubMed:20727954}. Chromosome, centromere, kinetochore {ECO:0000250|UniProtKB:O15392}. Midbody {ECO:0000269|PubMed:20727954}. Note=Localizes at the centromeres from prophase to metaphase, at the spindle midzone during anaphase and a the midbody during telophase and cytokinesis. Accumulates in the nucleus upon treatment with leptomycin B (LMB), a XPO1/CRM1 nuclear export inhibitor (PubMed:20727954). Localizes on chromosome arms and inner centromeres from prophase through metaphase. Localizes to kinetochores in metaphase, distributes to the midzone microtubules in anaphase and at telophase, localizes exclusively to the midbody. Colocalizes with AURKB at mitotic chromosomes (By similarity). {ECO:0000250|UniProtKB:O15392, ECO:0000269|PubMed:20627126, ECO:0000269|PubMed:20727954, ECO:0000269|PubMed:21364656}. |
| Modified Residue | MOD_RES 20; /note=Phosphoserine; by AURKC; /evidence=ECO:0000250|UniProtKB:O15392; MOD_RES 23; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:O15392; MOD_RES 34; /note=Phosphothreonine; by CDK1 and CDK15; /evidence=ECO:0000250|UniProtKB:O15392; MOD_RES 48; /note=Phosphothreonine; by CK2; in vitro; /evidence=ECO:0000250|UniProtKB:O15392; MOD_RES 90; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:O15392; MOD_RES 110; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:O15392; MOD_RES 112; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:O15392; MOD_RES 115; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:O15392; MOD_RES 117; /note=Phosphothreonine; by AURKB; /evidence=ECO:0000250|UniProtKB:O15392 |
| Post Translational Modification | PTM: Ubiquitinated by the Cul9-RING ubiquitin-protein ligase complex, leading to its degradation. Ubiquitination is required for centrosomal targeting. {ECO:0000250|UniProtKB:O15392}.; PTM: In vitro phosphorylation at Thr-117 by AURKB prevents interaction with INCENP and localization to mitotic chromosomes. Phosphorylation at Thr-48 by CK2 is critical for its mitotic and anti-apoptotic activities. Phosphorylation at Thr-34 by CDK15 is critical for its anti-apoptotic activity. Phosphorylation at Ser-20 by AURKC is critical for regulation of proper chromosome alignment and segregation, and possibly cytokinesis. {ECO:0000250|UniProtKB:O15392}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,356 |
| Kinetics | |
| Metal Binding | METAL 57; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU00029; METAL 60; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU00029; METAL 77; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU00029; METAL 84; /note=Zinc; /evidence=ECO:0000255|PROSITE-ProRule:PRU00029 |
| Rhea ID | |
| Cross Reference Brenda |