| IED ID | IndEnz0002005168 |
| Enzyme Type ID | protease005168 |
| Protein Name |
Autophagy-related protein 8i Autophagy-related ubiquitin-like modifier ATG8i AtAPG8i Protein autophagy 8i |
| Gene Name | ATG8I APG8I At3g15580 MQD17.3 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MKSFKEQYTLDERLAESREIIAKYPTRIPVIAEKYCKTDLPAIEKKKFLVPRDMSVGQFIYILSARLHLSPGKALFVFVNNTLPQTAALMDSVYESYKDDDGFVYMCYSSEKTFG |
| Enzyme Length | 115 |
| Uniprot Accession Number | Q9LRP7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Ubiquitin-like modifier involved in autophagosomes formation. May mediate the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. {ECO:0000250|UniProtKB:P38182}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Lipidation (1) |
| Keywords | Autophagy;Cytoplasm;Cytoplasmic vesicle;Cytoskeleton;Lipoprotein;Membrane;Microtubule;Protein transport;Reference proteome;Transport;Ubl conjugation pathway;Vacuole |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasmic vesicle, autophagosome membrane {ECO:0000250|UniProtKB:P38182}; Lipid-anchor {ECO:0000250|UniProtKB:P38182}. Vacuole membrane {ECO:0000250|UniProtKB:P38182}; Lipid-anchor {ECO:0000250|UniProtKB:P38182}. Cytoplasm, cytoskeleton {ECO:0000250|UniProtKB:Q8LEM4}. |
| Modified Residue | |
| Post Translational Modification | PTM: Gly-115 forms then a thioester bond with the 'Cys-558' of ATG7 (E1-like activating enzyme) before being transferred to the 'Cys-258' of ATG3 (the specific E2 conjugating enzyme), in order to be finally amidated with phosphatidylethanolamine. This lipid modification anchors ATG8 to autophagosomes. {ECO:0000250|UniProtKB:P38182}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14617064; 15860017; 16040659; 16159328; 16354162; 16367961; 17885809; 18552202; 18650403; 18775970; 23800962; 30955882; 32810441; |
| Motif | |
| Gene Encoded By | |
| Mass | 13,251 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |