| IED ID | IndEnz0002005191 |
| Enzyme Type ID | protease005191 |
| Protein Name |
Charged multivesicular body protein 3 Chromatin-modifying protein 3 Neuroendocrine differentiation factor Vacuolar protein sorting-associated protein 24 hVps24 |
| Gene Name | CHMP3 CGI149 NEDF VPS24 CGI-149 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS |
| Enzyme Length | 222 |
| Uniprot Accession Number | Q9Y3E7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Selectively binds to phosphatidylinositol 3,5-bisphosphate PtdIns(3,5)P2 and PtdIns(3,4)P2 in preference to other phosphoinositides tested. Involved in late stages of cytokinesis. Plays a role in endosomal sorting/trafficking of EGF receptor. Isoform 2 prevents stress-mediated cell death and accumulation of reactive oxygen species when expressed in yeast cells. {ECO:0000269|PubMed:14505570, ECO:0000269|PubMed:15707591, ECO:0000269|PubMed:16740483, ECO:0000269|PubMed:17331679, ECO:0000269|PubMed:18076377}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (3); Beta strand (2); Chain (1); Coiled coil (2); Cross-link (1); Helix (6); Initiator methionine (1); Lipidation (1); Modified residue (1); Motif (1); Mutagenesis (16); Region (8); Sequence conflict (1); Site (2); Turn (1) |
| Keywords | 3D-structure;Alternative splicing;Apoptosis;Cell cycle;Cell division;Coiled coil;Cytoplasm;Endosome;Isopeptide bond;Lipoprotein;Membrane;Myristate;Phosphoprotein;Protein transport;Reference proteome;Transport;Ubl conjugation |
| Interact With | O43633; Q9UQN3; Q9H444; O95630; O43633; Itself; O95630 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytosol. Membrane; Lipid-anchor. Endosome. Late endosome membrane {ECO:0000305}. Note=Localizes to the midbody of dividing cells. |
| Modified Residue | MOD_RES 200; /note="Phosphoserine"; /evidence="ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (4) |
| Cross Reference PDB | 2GD5; 2XZE; 3FRT; 3FRV; |
| Mapped Pubmed ID | 11563910; 12878588; 15075231; 15231748; 15331731; 15473846; 16302002; 16371348; 16554368; 16973552; 17686835; 17711858; 18654987; 19302785; 19527882; 19615732; 19640981; 20195357; 20360068; 21238931; 21674799; 21799305; 22762019; 23051622; 23305486; 24440309; 25135833; 25416956; 25568151; 26040712; 26040713; 26496610; 27281216; 27418190; 28242692; 29898893; 30513301; 31231549; 31541468; 34597582; |
| Motif | MOTIF 201..211; /note=MIT-interacting motif |
| Gene Encoded By | |
| Mass | 25,073 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |