| IED ID |
IndEnz0002005202 |
| Enzyme Type ID |
protease005202 |
| Protein Name |
Probable derlin-2 homolog
|
| Gene Name |
derl2 DDB_G0285131 |
| Organism |
Dictyostelium discoideum (Slime mold) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Amoebozoa
Evosea
Eumycetozoa
Dictyostelia (dictyostelid cellular slime molds)
Dictyosteliales
Dictyosteliaceae
Dictyostelium
Dictyostelium discoideum (Slime mold)
|
| Enzyme Sequence |
MAQPFEDWYKNLPIVTKIYMTGCVVTSVSVYLGLVGPLRLYLNFPLVFGKYEFWRLFTNFFFYDEIGMNFFFHMYFLVRHSRLLEESSFRGRSADYLFMWIFGSFLLLIMDAFLFYTKIVTKVLFLAPSIAFMVIYVWSRRNPNMHISFLGLFTFSAPYLPWVILIMGYLFNHDLTTDLLGAVAGHAYYFLEDAYPLISNRRLLKTPGFLKNLMDGQEQPIVDAHQQQEVQQAQQQEVQQPVQNFLNEDDLDQQ |
| Enzyme Length |
254 |
| Uniprot Accession Number |
Q54NN1 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins. May also be involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation. {ECO:0000250|UniProtKB:Q9GZP9}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Topological domain (5); Transmembrane (4) |
| Keywords |
Endoplasmic reticulum;Membrane;Reference proteome;Transmembrane;Transmembrane helix;Unfolded protein response |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q9GZP9}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q9GZP9}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
29,964 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|