| IED ID | IndEnz0002005210 |
| Enzyme Type ID | protease005210 |
| Protein Name |
Desumoylating isopeptidase 1 DeSI-1 EC 3.4.-.- PPPDE peptidase domain-containing protein 2 |
| Gene Name | Desi1 D15Wsu75e Fam152b Pppde2 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSSGISSCTPGGTLLGPPDSVVDVGNTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPFLDSIQIQPPGGNSVGRPNGQS |
| Enzyme Length | 168 |
| Uniprot Accession Number | Q9CQT7 |
| Absorption | |
| Active Site | ACT_SITE 38; /evidence="ECO:0000255|PROSITE-ProRule:PRU01205, ECO:0000269|PubMed:22498933"; ACT_SITE 108; /evidence="ECO:0000255|PROSITE-ProRule:PRU01205, ECO:0000269|PubMed:22498933" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Protease which deconjugates SUMO1, SUMO2 and SUMO3 from some substrate proteins (PubMed:22370726, PubMed:22498933). Has isopeptidase but not SUMO-processing activity (PubMed:22370726, PubMed:22498933). Desumoylates ZBTB46 (PubMed:22370726). Collaborates with UBQLN4 in the export of ubiquitinated proteins from the nucleus to the cytoplasm (By similarity). {ECO:0000250|UniProtKB:Q6ICB0, ECO:0000269|PubMed:22370726, ECO:0000269|PubMed:22498933}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (5); Chain (1); Domain (1); Helix (7); Motif (2); Sequence conflict (1); Turn (3) |
| Keywords | 3D-structure;Cytoplasm;Hydrolase;Nucleus;Protease;Reference proteome |
| Interact With | Itself; Q8BID6 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:22370726}. Nucleus {ECO:0000269|PubMed:22370726}. Note=Shuttles between the nucleus and the cytoplasm; exported from the nucleus in a XPO1/CRM1-dependent manner via its nuclear export signal motifs. {ECO:0000250|UniProtKB:Q6ICB0}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 2WP7; |
| Mapped Pubmed ID | 10725249; 11217851; 12466851; 14610273; 15306695; 9811942; |
| Motif | MOTIF 83..91; /note=Nuclear export signal 1; /evidence=ECO:0000250|UniProtKB:Q6ICB0; MOTIF 139..153; /note=Nuclear export signal 2; /evidence=ECO:0000250|UniProtKB:Q6ICB0 |
| Gene Encoded By | |
| Mass | 18,385 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |