| IED ID | IndEnz0002005233 |
| Enzyme Type ID | protease005233 |
| Protein Name |
F-box/WD repeat-containing protein 11 F-box and WD repeats protein beta-TrCP2 F-box/WD repeat-containing protein 1B Homologous to Slimb protein HOS |
| Gene Name | FBXW11 BTRCP2 FBW1B FBXW1B KIAA0696 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR |
| Enzyme Length | 542 |
| Uniprot Accession Number | Q9UKB1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. SCF(FBXW11) mediates the ubiquitination of phosphorylated CTNNB1 and participates in Wnt signaling regulation. SCF(FBXW11) mediates the ubiquitination of phosphorylated NFKBIA, which degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. SCF(FBXW11) mediates the ubiquitination of IFNAR1. SCF(FBXW11) mediates the ubiquitination of CEP68; this is required for centriole separation during mitosis (PubMed:25503564). Involved in the oxidative stress-induced a ubiquitin-mediated decrease in RCAN1. Mediates the degradation of CDC25A induced by ionizing radiation in cells progressing through S phase and thus may function in the intra-S-phase checkpoint. Has an essential role in the control of the clock-dependent transcription via degradation of phosphorylated PER1 and phosphorylated PER2. SCF(FBXW11) mediates the ubiquitination of CYTH1, and probably CYTH2 (PubMed:29420262). {ECO:0000269|PubMed:10321728, ECO:0000269|PubMed:10437795, ECO:0000269|PubMed:10644755, ECO:0000269|PubMed:10648623, ECO:0000269|PubMed:14532120, ECO:0000269|PubMed:14603323, ECO:0000269|PubMed:15917222, ECO:0000269|PubMed:18575781, ECO:0000269|PubMed:19966869, ECO:0000269|PubMed:20347421, ECO:0000269|PubMed:25503564, ECO:0000269|PubMed:29420262}.; FUNCTION: (Microbial infection) Target of human immunodeficiency virus type 1 (HIV-1) protein VPU to polyubiquitinate and deplete BST2 from cells and antagonize its antiviral action. {ECO:0000269|PubMed:19730691}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Beta strand (29); Chain (1); Domain (1); Erroneous initiation (1); Helix (10); Natural variant (7); Region (1); Repeat (7); Turn (4) |
| Keywords | 3D-structure;Alternative splicing;Biological rhythms;Cell cycle;Cytoplasm;Disease variant;Host-virus interaction;Nucleus;Reference proteome;Repeat;Ubl conjugation pathway;WD repeat;Wnt signaling pathway |
| Interact With | Q5JTC6; O15169; P35222; Q13616; P32314; P17181; Q3KP66; Q00987; Q16236; P25963; Q13127; P63208; P30291; Q60793 |
| Induction | INDUCTION: Expression is negatively regulated by Wnt/beta-catenin pathway. {ECO:0000269|PubMed:11850814}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Nucleus {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 6WNX; |
| Mapped Pubmed ID | 10230406; 10514424; 10597293; 11158290; 11961546; 12482991; 12504025; 12504026; 12609982; 12646216; 14514672; 14673179; 14676825; 14743216; 15070733; 15340381; 15537541; 15611062; 15688063; 15799966; 16303288; 16401342; 16647857; 16865294; 16943200; 16954532; 17183367; 17353931; 17497243; 18093314; 18206966; 18378770; 18775313; 18805092; 18826954; 18851830; 18926707; 19028597; 19159283; 19250909; 19489725; 19615732; 19617556; 19748355; 19874575; 20562859; 20708156; 21138764; 21463634; 21778237; 21863050; 21900206; 21940857; 22045853; 22190034; 22682247; 22810585; 22851693; 22939624; 22959436; 23201271; 23453757; 23455922; 23535662; 23535663; 23563313; 23583660; 23611780; 24076655; 24366813; 25241761; 25314029; 25332235; 25349211; 25355947; 25531226; 25609649; 26632597; 26638075; 26906416; 27565346; 29555946; 30031111; 31685992; 33021036; 33131925; 7479848; 8550590; 8706131; 9346238; 9859996; 9990852; 9990853; |
| Motif | |
| Gene Encoded By | |
| Mass | 62,091 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |