IED ID | IndEnz0002005251 |
Enzyme Type ID | protease005251 |
Protein Name |
HTH-type transcriptional regulator Hpr Protease production regulatory protein Hpr |
Gene Name | hpr BCG9842_B4223 |
Organism | Bacillus cereus (strain G9842) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus cereus group Bacillus cereus Bacillus cereus (strain G9842) |
Enzyme Sequence | MKSGEKDYSVKEAMIFSQRIAQLSKALWKCVEKDWQQWIKPYDLNINEHHILTIAYHLKGASISEIAKFGVMHVSTAFNFSKKLEERGYLVFSKKEDDKRNTYIEITDKGEELLLRLMEEYDPENNSVFNGALALRNFYGKFPENIELIAILRNIYGQDFIDIFEKSLEDIEENFTESDQKLVKK |
Enzyme Length | 185 |
Uniprot Accession Number | B7IKC1 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | DNA_BIND 63..86; /note=H-T-H motif; /evidence=ECO:0000255|HAMAP-Rule:MF_01911 |
EC Number | |
Enzyme Function | FUNCTION: Negative regulator of protease production and sporulation. {ECO:0000255|HAMAP-Rule:MF_01911}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); DNA binding (1); Domain (1) |
Keywords | DNA-binding;Repressor;Sporulation;Transcription;Transcription regulation |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 21,730 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |