| IED ID | IndEnz0002005272 |
| Enzyme Type ID | protease005272 |
| Protein Name |
DNA-binding transcriptional repressor ScoC HTH-type transcriptional regulator Hpr Protease production regulatory protein Hpr |
| Gene Name | hpr catA scoC BSU09990 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MNRVEPPYDVKEALVFTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLNDKRNTYVQLTEEGTEVFWSLLEEFDPTRNAVFKGSQPLYHLFGKFPEVAEMMCMIRHIYGDDFMEIFETSLTNIDNDFESVNGKLKKKAKDSAADEPAEELEPVNS |
| Enzyme Length | 203 |
| Uniprot Accession Number | P11065 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 63..86; /note=H-T-H motif; /evidence=ECO:0000255|HAMAP-Rule:MF_01911 |
| EC Number | |
| Enzyme Function | FUNCTION: Negative regulator of protease production and sporulation. Acts by binding directly to the promoter of protease genes (aprE and nprE), and by repressing oligopeptide permease operons (appABCDF and oppABCDF), thereby preventing uptake of oligopeptides required for initiation of sporulation. Acts with SinR as a corepressor of epr expression. Binds to non-m6A-5-methylated 5'-GACGAG-3' sites, tested with scpA; when the target is methylated by DnmA, this repressor no longer binds and transcription is up-regulated (PubMed:32324221). {ECO:0000255|HAMAP-Rule:MF_01911, ECO:0000269|PubMed:10383984, ECO:0000269|PubMed:16923912, ECO:0000269|PubMed:1906467, ECO:0000269|PubMed:32324221}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); DNA binding (1); Domain (1); Helix (11); Region (1); Turn (1) |
| Keywords | 3D-structure;DNA-binding;Direct protein sequencing;Reference proteome;Repressor;Sporulation;Transcription;Transcription regulation |
| Interact With | O34483 |
| Induction | INDUCTION: Negatively regulated by the Mrp homolog protein SalA and by SenS. {ECO:0000269|PubMed:15126467, ECO:0000269|PubMed:16321961}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 2FXA; |
| Mapped Pubmed ID | 25278935; |
| Motif | |
| Gene Encoded By | |
| Mass | 23,713 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |