| IED ID | IndEnz0002005296 |
| Enzyme Type ID | protease005296 |
| Protein Name |
ATP-dependent protease ATPase subunit HslU Unfoldase HslU Fragment |
| Gene Name | hslU |
| Organism | Buchnera aphidicola subsp. Schlechtendalia chinensis |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Erwiniaceae Buchnera (aphid P-endosymbionts) Buchnera aphidicola Buchnera aphidicola subsp. Schlechtendalia chinensis |
| Enzyme Sequence | MRHIAEAAWKVNESIENIGARRLYTVLEHLMEDISYNSCNNKNELVINIDEEYVSKHLDELILNNDLNRFIL |
| Enzyme Length | 72 |
| Uniprot Accession Number | O69227 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 21; /note=ATP; /evidence=ECO:0000250 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU are essential for unfolding of protein substrates subsequently hydrolyzed by HslV. HslU recognizes the N-terminal part of its protein substrates and unfolds these before they are guided to HslV for hydrolysis (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Binding site (1); Chain (1); Non-terminal residue (1) |
| Keywords | ATP-binding;Chaperone;Cytoplasm;Nucleotide-binding |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,502 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |