IED ID | IndEnz0002005334 |
Enzyme Type ID | protease005334 |
Protein Name |
Haptoglobin Cleaved into: Haptoglobin alpha chain; Haptoglobin beta chain |
Gene Name | HP |
Organism | Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Ponginae Pongo Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii) |
Enzyme Sequence | MSALGAVIALLLWGQLFAVDSGNDVMDISDDGCPKPPQIAHGYVEHSVRYQCKNYYRLRTEGDGVYTLNSEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSRHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVPVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTEHLKYVMLPVADQDQCVRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAKN |
Enzyme Length | 347 |
Uniprot Accession Number | Q5R5F6 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidly cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (3); Disulfide bond (5); Domain (2); Glycosylation (4); Region (1); Sequence conflict (2); Signal peptide (1) |
Keywords | Acute phase;Antibiotic;Antimicrobial;Antioxidant;Disulfide bond;Glycoprotein;Hemoglobin-binding;Immunity;Reference proteome;Secreted;Serine protease homolog;Signal;Sushi |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 38,496 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |