| IED ID | IndEnz0002005375 |
| Enzyme Type ID | protease005375 |
| Protein Name |
Pre-core protein X pX 11 kDa core protein Protein mu pMu Cleaved into: Core protein X |
| Gene Name | L2 |
| Organism | Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Mastadenovirus Human mastadenovirus C Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) |
| Enzyme Sequence | MALTCRLRFPVPGFRGRMHRRRGMAGHGLTGGMRRAHHRRRRASHRRMRGGILPLLIPLIAAAIGAVPGIASVALQAQRH |
| Enzyme Length | 80 |
| Uniprot Accession Number | P14269 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: [Pre-core protein X]: Interacts with the viral DNA and aids in tightly condensing it within the capsid. Cleavage of pre-core protein X may serve to partially relax this structure within the mature virion prior to its entry into the nucleus. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Initiator methionine (1); Peptide (1); Propeptide (2); Region (1); Site (2) |
| Keywords | DNA-binding;Direct protein sequencing;Host nucleus;Late protein;Reference proteome;Virion |
| Interact With | |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. |
| Subcellular Location | SUBCELLULAR LOCATION: [Pre-core protein X]: Host nucleus, host nucleolus. Note=Excluded from adenovirus DNA-binding protein (DBP)-rich replication centers in adenovirus-infected cells.; SUBCELLULAR LOCATION: [Core protein X]: Virion. Note=Located inside the capsid in association with the viral DNA (core). Present in about 126-160 copies per virion. Excluded from adenovirus DNA-binding protein (DBP)-rich replication centers in adenovirus-infected cells. |
| Modified Residue | |
| Post Translational Modification | PTM: Cleaved by the viral protease during virion maturation to form the mature protein. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,846 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |