IED ID | IndEnz0002005382 |
Enzyme Type ID | protease005382 |
Protein Name |
COP9 signalosome complex subunit 5a Signalosome subunit 5a EC 3.4.-.- Jun activation domain-binding homolog 1 |
Gene Name | CSN5A AJH1 CSN5B At1g22920 F19G10.12 |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
Enzyme Sequence | MEGSSSAIARKTWELENNILPVEPTDSASDSIFHYDDASQAKIQQEKPWASDPNYFKRVHISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQSDAYEYMVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGGIAPAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNSARQSKKSADDSSDPEPMITS |
Enzyme Length | 357 |
Uniprot Accession Number | Q8LAZ7 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.4.-.- |
Enzyme Function | FUNCTION: Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex (By similarity). The CSN complex is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of PSIAA6 by regulating the activity of the Ubl ligase SCF-TIR complex. Involved in CSN's deneddylation/derubylation activity (PubMed:15486099). Required for the deneddylation of all cullins (PubMed:15923347, PubMed:17307927). Essential for the structural integrity of the CSN holocomplex (PubMed:17307927). {ECO:0000250, ECO:0000269|PubMed:11337587, ECO:0000269|PubMed:15486099, ECO:0000269|PubMed:15923347, ECO:0000269|PubMed:17307927, ECO:0000269|PubMed:9811788}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Alternative sequence (1); Chain (1); Domain (1); Metal binding (3); Modified residue (1); Motif (1); Mutagenesis (6); Region (1); Sequence conflict (2) |
Keywords | Acetylation;Alternative splicing;Cytoplasm;Developmental protein;Hydrolase;Metal-binding;Metalloprotease;Nucleus;Phytochrome signaling pathway;Protease;Reference proteome;Signalosome;Zinc |
Interact With | P45432; Q8W206; Q1EC57 |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:9811788}. Nucleus {ECO:0000269|PubMed:9811788}. |
Modified Residue | MOD_RES 1; /note=N-acetylmethionine; /evidence=ECO:0007744|PubMed:22223895 |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 10521526; 10607571; 10721695; 11019806; 11701877; 12223399; 12724534; 14570571; 15703063; 18434413; 18650403; 21798943; 22576848; 23086934; 23319550; 25211078; 26259174; 29940863; 30833711; 31795414; 9707402; |
Motif | MOTIF 142..155; /note=JAMM motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
Gene Encoded By | |
Mass | 39,731 |
Kinetics | |
Metal Binding | METAL 142; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 144; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 155; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
Rhea ID | |
Cross Reference Brenda |