| IED ID | IndEnz0002005393 |
| Enzyme Type ID | protease005393 |
| Protein Name |
COP9 signalosome complex subunit 6 Signalosome subunit 6 |
| Gene Name | cops6 csn6 TNeu117c08.1 |
| Organism | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Silurana Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
| Enzyme Sequence | MAAAAASNGSGMEVDVAAFPTVMAQGVTGSVTVALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSQINEEKITINKEYYYTKEEQFKQVFKDMEFLGWYTTGGTPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVYESVIDIVNGEATMLLAELSYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVRLILEYVRAAEAGEVPFNHEILREASALCHCLPVLSTDKFKMDFYDQCNDVGLMSYLGTITKTCNTMNQFVNKFNILYDRQGIGRRMRGLFF |
| Enzyme Length | 319 |
| Uniprot Accession Number | Q07G98 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes (By similarity). The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity (By similarity). {ECO:0000250|UniProtKB:Q7L5N1}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1) |
| Keywords | Cytoplasm;Nucleus;Reference proteome;Signalosome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q7L5N1}. Nucleus {ECO:0000250|UniProtKB:Q7L5N1}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,655 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |