| IED ID | IndEnz0002005395 |
| Enzyme Type ID | protease005395 |
| Protein Name |
Putative inactive caspase B Cleaved into: Putative inactive caspase B subunit p31; Putative inactive caspase B subunit p17; Putative inactive caspase subunit p14 |
| Gene Name | csp-2 Y73B6BL.7 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MMCEDASDGKKIDETRKYRNNRSSKCRAIIINNVVFCGMEKRIGSDKDKKKLSKLFERLGYQSTSYDNLKSSEILETVRQFTQSNHGDSLIITIMSHGDQGLLYGVDGVPVQMLDIIDLMCTASLAKKPKWLMCVCCRGDRIDRAVRCDGFIDNFFDRFPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVIIENAKDTHLADLLMETNRRVVEKYEADKVVIVCKQAPEFWSRFTKQLFFDV |
| Enzyme Length | 263 |
| Uniprot Accession Number | Q9TZP5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: [Isoform b]: Putative inactive caspase (PubMed:9857046). In the germline, binds caspase ced-3 zymogen and prevents ced-3 autoactivation. Does not affect the caspase activity of mature ced-3 and ced-4-mediated mature ced-3 activation (PubMed:19575016). Negatively regulates germline apoptosis by inhibiting autocleavage of caspase ced-3 (PubMed:19575016). Involved in fertility (PubMed:19575016). {ECO:0000269|PubMed:19575016, ECO:0000269|PubMed:9857046}.; FUNCTION: [Isoform a]: Putative inactive caspase (PubMed:9857046). Dispensable for the inhibition of germline apoptosis (PubMed:19575016). {ECO:0000269|PubMed:19575016, ECO:0000303|PubMed:9857046}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Chain (3); Mutagenesis (4); Propeptide (1) |
| Keywords | Alternative splicing;Cytoplasm;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: [Isoform b]: Cytoplasm {ECO:0000269|PubMed:19575016}. |
| Modified Residue | |
| Post Translational Modification | PTM: Cleavage by csp-1 isoform b or ced-3 removes the propeptide and generates subunit p31 in vitro. An additional cleavage at Asp-149 generates the 2 subunits p17 and p14 but this cleavage appears to be less efficient. {ECO:0000269|PubMed:9857046}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10778742; 17164286; 19343510; 20439776; 21085631; 21177967; 21367940; 22267497; 22347378; 22560298; 23540702; 23800452; 24884423; 25378320; 25487147; 6593563; |
| Motif | |
| Gene Encoded By | |
| Mass | 30,401 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |