| IED ID | IndEnz0002005439 |
| Enzyme Type ID | protease005439 |
| Protein Name |
Cystatin-A Cystatin-AS Stefin-A Cleaved into: Cystatin-A, N-terminally processed |
| Gene Name | CSTA STF1 STFA |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF |
| Enzyme Length | 98 |
| Uniprot Accession Number | P01040 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This is an intracellular thiol proteinase inhibitor. Has an important role in desmosome-mediated cell-cell adhesion in the lower levels of the epidermis. {ECO:0000269|PubMed:21944047}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Chain (2); Helix (4); Initiator methionine (1); Modified residue (1); Motif (1); Natural variant (1); Site (1) |
| Keywords | 3D-structure;Acetylation;Cell adhesion;Cytoplasm;Direct protein sequencing;Ichthyosis;Protease inhibitor;Reference proteome;Thiol protease inhibitor |
| Interact With | G5E9A7; P28799; P04792; Q9Y3C5; Q7Z699; O76024; P00784 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:21944047}. |
| Modified Residue | MOD_RES 1; /note=N-acetylmethionine; /evidence=ECO:0000250|UniProtKB:P01039 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (7); X-ray crystallography (5) |
| Cross Reference PDB | 1CYU; 1CYV; 1DVC; 1DVD; 1GD3; 1GD4; 1N9J; 1NB3; 1NB5; 3K9M; 3KFQ; 3KSE; |
| Mapped Pubmed ID | 10066784; 10411887; 10771479; 11350120; 11451947; 11532941; 11590230; 12581647; 12682854; 12836678; 12902340; 14747998; 15048832; 15175029; 16169070; 16342276; 16639001; 16969475; 17412564; 17441792; 17515931; 17985332; 18364739; 19463016; 19615732; 19933866; 20461718; 20562859; 20860624; 21038029; 21325429; 21412248; 21654840; 22615763; 22787201; 23534700; 23546957; 24189400; 24366813; 24705354; 25609649; 25785582; 26212323; 26634210; 26676054; 26753874; 26967115; 28119996; 28898495; 29086922; 29246862; 29642180; 30854931; 31926189; 33831734; 7543090; 8999895; 9395522; 9565599; |
| Motif | MOTIF 46..50; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 11,006 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |