| IED ID | IndEnz0002005450 |
| Enzyme Type ID | protease005450 |
| Protein Name |
Proteinase p15 EC 3.4.23.- |
| Gene Name | gag |
| Organism | Avian myeloblastosis associated virus (MAV) |
| Taxonomic Lineage | Viruses Riboviria Pararnavirae Artverviricota Revtraviricetes Ortervirales Retroviridae Orthoretrovirinae Alpharetrovirus unclassified Alpharetrovirus Avian myeloblastosis associated virus (MAV) |
| Enzyme Sequence | LAMTMEHKDRPLVRVILTNTGSHPVKQRSVYITALLDSGADITIISEEDWPTDWPVMEAANPQIHGIGGGIPMRKSRDMIEVGVINRDGSLERPLLLFPAVAMVRGSILGRDCLQGLGLRLTNL |
| Enzyme Length | 124 |
| Uniprot Accession Number | P26315 |
| Absorption | |
| Active Site | ACT_SITE 37 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.23.- |
| Enzyme Function | FUNCTION: Specifically liberates the five major structural proteins from the common gag precursor, as well as reverse transcriptase and integrase from the gag-pol precursor. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Beta strand (13); Chain (1); Domain (1); Helix (1); Turn (1) |
| Keywords | 3D-structure;Aspartyl protease;Direct protein sequencing;Hydrolase;Protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1MVP; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 13,596 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.23.B13; |