| IED ID | IndEnz0002005458 |
| Enzyme Type ID | protease005458 |
| Protein Name |
RxLR effector protein Avh240 Avirulence homolog protein 240 |
| Gene Name | Avh240 |
| Organism | Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) |
| Taxonomic Lineage | cellular organisms Eukaryota Sar Stramenopiles Oomycota Peronosporales Peronosporaceae Phytophthora Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) |
| Enzyme Sequence | MRPYFTLLLALAFILACTNLVEADAGRVLETTTNEHARHLRTAVASVVDLPDDEDERLLGYNTVQLWRMRRTANKLMNGKLTTQKEAALKKWMASQQDKFLAKWLKSSSVYPDQVYSKLGLTKLGASAKSSPNYQLYEKYTEALLQRWTNFKASPDTVYKSLRLDKLGAKAPQSPSYPMYEKYLQTFFRNQPAN |
| Enzyme Length | 194 |
| Uniprot Accession Number | E0W4T1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Effector that suppresses plant defense responses during the early stages of pathogen infection (PubMed:21653195). Suppresses cell death induced by effectors and PAMPs in plant hosts (PubMed:21653195). Avh240 dimerizes and localizes at the plasma membrane to interfere with aspartic protease AP1 secretion, which presents an effective mechanism by which effector proteins suppress plant apoplastic immunity (By similarity). {ECO:0000250|UniProtKB:G5A8M1, ECO:0000269|PubMed:21653195}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Motif (1); Region (1); Signal peptide (1) |
| Keywords | Host cell membrane;Host membrane;Membrane;Secreted;Signal;Virulence |
| Interact With | |
| Induction | INDUCTION: Expression is strongly up-regulated during the early stages of infection. {ECO:0000269|PubMed:21653195}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:G5A8M1}. Host cell membrane {ECO:0000250|UniProtKB:G5A8M1}. Note=Plasma membrane localization is independent on self-dimerization but required for virulence. {ECO:0000250|UniProtKB:G5A8M1}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 38..57; /note=RxLR-dEER; /evidence=ECO:0000305|PubMed:21653195 |
| Gene Encoded By | |
| Mass | 22,225 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |